PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR12G04970.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family bZIP
Protein Properties Length: 391aa    MW: 42911.6 Da    PI: 7.6772
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR12G04970.2genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_121.93.7e-072592961754
                      HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1  17 ArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54 
                      A+rsR RK+++i+eLe++v++L++e  +   e++ l +
  LPERR12G04970.2 259 AQRSRVRKLQYIAELERRVQSLQTEGVEVSAEMDFLGQ 296
                      89**********************98887777776655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.1E-6248307IPR004827Basic-leucine zipper domain
CDDcd147036.81E-16249299No hitNo description
SuperFamilySSF579596.19E-6258301No hitNo description
Gene3DG3DSA:1.20.5.1708.0E-7259313No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 391 aa     Download sequence    Send to blast
MQFFSAEGEH AMMANARFQK QALLPPRSPF PAAASPSPSP HGELGPIARP RDGGPHRHGH  60
HQRTSSESVL IDEQPSWLDD LLDEPEAAAA PAARPHGRPG HRRSSSDSFT LFDGGNSAAA  120
AAMYDNVFDG MRGGGGGGGG HGQQVGGSWG GAPEFFPEPS SFGRPQGGHG RPWDNRQMLR  180
HGGGAGMPMP MPMREMNGGH RGPPGAFGDL EHGSLPNGVD RKVIGDIHDQ RVGAERKEGA  240
HLRHSQSEAD TKRAKQQYAQ RSRVRKLQYI AELERRVQSL QTEGVEVSAE MDFLGQQNIM  300
LDLENKALKQ RLESLSQEHL IKRFQQEMFE REIGRLRSLF QQQQQQQHMP QQQGPTHSRS  360
NSRDLDSQFA NMSLKHSDPN SGCDAVPGLR I
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015618309.10.0PREDICTED: uncharacterized protein At4g06598
TrEMBLA0A0D9XXN70.0A0A0D9XXN7_9ORYZ; Uncharacterized protein
STRINGORGLA12G0053300.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP33103666
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G58110.21e-45bZIP family protein